Lineage for d1iywb3 (1iyw B:190-342)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672724Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 672725Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 672726Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
    inserted into the catalytic domain
  6. 672745Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species)
  7. 672746Species Thermus thermophilus [TaxId:274] [50683] (5 PDB entries)
  8. 672754Domain d1iywb3: 1iyw B:190-342 [83813]
    Other proteins in same PDB: d1iywa1, d1iywa2, d1iywa4, d1iywb1, d1iywb2, d1iywb4
    preliminary structure of ligand-free enzyme; CA-atoms only

Details for d1iywb3

PDB Entry: 1iyw (more details), 4 Å

PDB Description: preliminary structure of thermus thermophilus ligand-free valyl-trna synthetase
PDB Compounds: (B:) valyl-tRNA synthetase

SCOP Domain Sequences for d1iywb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iywb3 b.51.1.1 (B:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte
vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal
rgldrfearrkavelfreaghlvkeedytiala

SCOP Domain Coordinates for d1iywb3:

Click to download the PDB-style file with coordinates for d1iywb3.
(The format of our PDB-style files is described here.)

Timeline for d1iywb3: