Class a: All alpha proteins [46456] (284 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species) includes additional alpha+beta (sub)domain at the C-terminus |
Species Thermus thermophilus [TaxId:274] [47332] (3 PDB entries) |
Domain d1iywb2: 1iyw B:579-796 [83812] Other proteins in same PDB: d1iywa1, d1iywa3, d1iywa4, d1iywb1, d1iywb3, d1iywb4 preliminary structure of ligand-free enzyme; CA-atoms only |
PDB Entry: 1iyw (more details), 4 Å
SCOPe Domain Sequences for d1iywb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iywb2 a.27.1.1 (B:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen levfrflsradllperpakalvkamprvtarmplegll
Timeline for d1iywb2:
View in 3D Domains from other chains: (mouse over for more information) d1iywa1, d1iywa2, d1iywa3, d1iywa4 |