Lineage for d1iywb2 (1iyw B:579-796)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086250Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1086251Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 1086252Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1086299Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species)
    includes additional alpha+beta (sub)domain at the C-terminus
  7. 1086300Species Thermus thermophilus [TaxId:274] [47332] (3 PDB entries)
  8. 1086306Domain d1iywb2: 1iyw B:579-796 [83812]
    Other proteins in same PDB: d1iywa1, d1iywa3, d1iywa4, d1iywb1, d1iywb3, d1iywb4
    preliminary structure of ligand-free enzyme; CA-atoms only

Details for d1iywb2

PDB Entry: 1iyw (more details), 4 Å

PDB Description: preliminary structure of thermus thermophilus ligand-free valyl-trna synthetase
PDB Compounds: (B:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1iywb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iywb2 a.27.1.1 (B:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy
elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke
elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen
levfrflsradllperpakalvkamprvtarmplegll

SCOPe Domain Coordinates for d1iywb2:

Click to download the PDB-style file with coordinates for d1iywb2.
(The format of our PDB-style files is described here.)

Timeline for d1iywb2: