Lineage for d1iywb1 (1iyw B:797-862)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077568Superfamily a.2.7: tRNA-binding arm [46589] (4 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 1077585Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein)
  6. 1077586Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species)
  7. 1077587Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries)
  8. 1077593Domain d1iywb1: 1iyw B:797-862 [83811]
    Other proteins in same PDB: d1iywa2, d1iywa3, d1iywa4, d1iywb2, d1iywb3, d1iywb4
    preliminary structure of ligand-free enzyme; CA-atoms only

Details for d1iywb1

PDB Entry: 1iyw (more details), 4 Å

PDB Description: preliminary structure of thermus thermophilus ligand-free valyl-trna synthetase
PDB Compounds: (B:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1iywb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iywb1 a.2.7.3 (B:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]}
dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire
alsqig

SCOPe Domain Coordinates for d1iywb1:

Click to download the PDB-style file with coordinates for d1iywb1.
(The format of our PDB-style files is described here.)

Timeline for d1iywb1: