Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Valyl-tRNA synthetase (ValRS) [52390] (1 species) |
Species Thermus thermophilus [TaxId:274] [52391] (3 PDB entries) |
Domain d1iywa4: 1iyw A:1-189,A:343-578 [83810] Other proteins in same PDB: d1iywa1, d1iywa2, d1iywa3, d1iywb1, d1iywb2, d1iywb3 preliminary structure of ligand-free enzyme; CA-atoms only |
PDB Entry: 1iyw (more details), 4 Å
SCOPe Domain Sequences for d1iywa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iywa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce ttlsdleveXtcsrcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmd wlenvkdwnisrqlwwghqipawycedcqavnvprperyledptsceacgsprlkrdedv fdtwfssalwplstlgwpeetedlkafypgdvlvtgydilflwvsrmevsgyhfmgerpf ktvllhglvldekgqkmskskgnvidplemverygadalrfaliylatggqdirldlrwl emarnf
Timeline for d1iywa4:
View in 3D Domains from other chains: (mouse over for more information) d1iywb1, d1iywb2, d1iywb3, d1iywb4 |