Lineage for d1iywa4 (1iyw A:1-189,A:343-578)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359293Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1359498Protein Valyl-tRNA synthetase (ValRS) [52390] (1 species)
  7. 1359499Species Thermus thermophilus [TaxId:274] [52391] (3 PDB entries)
  8. 1359504Domain d1iywa4: 1iyw A:1-189,A:343-578 [83810]
    Other proteins in same PDB: d1iywa1, d1iywa2, d1iywa3, d1iywb1, d1iywb2, d1iywb3
    preliminary structure of ligand-free enzyme; CA-atoms only

Details for d1iywa4

PDB Entry: 1iyw (more details), 4 Å

PDB Description: preliminary structure of thermus thermophilus ligand-free valyl-trna synthetase
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1iywa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iywa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
ttlsdleveXtcsrcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmd
wlenvkdwnisrqlwwghqipawycedcqavnvprperyledptsceacgsprlkrdedv
fdtwfssalwplstlgwpeetedlkafypgdvlvtgydilflwvsrmevsgyhfmgerpf
ktvllhglvldekgqkmskskgnvidplemverygadalrfaliylatggqdirldlrwl
emarnf

SCOPe Domain Coordinates for d1iywa4:

Click to download the PDB-style file with coordinates for d1iywa4.
(The format of our PDB-style files is described here.)

Timeline for d1iywa4: