Lineage for d1iyma1 (1iym A:129-181)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264069Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2264092Protein EL5 RING-H2 domain [90220] (1 species)
    binding domain for E2 ubiquitin ligase
  7. 2264093Species Rice (Oryza sativa) [TaxId:4530] [90221] (1 PDB entry)
  8. 2264094Domain d1iyma1: 1iym A:129-181 [83806]
    Other proteins in same PDB: d1iyma2
    complexed with zn

Details for d1iyma1

PDB Entry: 1iym (more details)

PDB Description: RING-H2 finger domain of EL5
PDB Compounds: (A:) el5

SCOPe Domain Sequences for d1iyma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyma1 g.44.1.1 (A:129-181) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}
ddgvecavclaeledgeearflprcghgfhaecvdmwlgshstcplcrltvvv

SCOPe Domain Coordinates for d1iyma1:

Click to download the PDB-style file with coordinates for d1iyma1.
(The format of our PDB-style files is described here.)

Timeline for d1iyma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyma2