Lineage for d1iyma_ (1iym A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344558Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 344559Superfamily g.44.1: RING/U-box [57850] (2 families) (S)
  5. 344560Family g.44.1.1: RING finger domain, C3HC4 [57851] (10 proteins)
  6. 344573Protein EL5 RING-H2 domain [90220] (1 species)
    binding domain for E2 ubiquitin ligase
  7. 344574Species Rice (Oliza sativa) [90221] (1 PDB entry)
  8. 344575Domain d1iyma_: 1iym A: [83806]
    complexed with zn

Details for d1iyma_

PDB Entry: 1iym (more details)

PDB Description: RING-H2 finger domain of EL5
PDB Compounds: (A:)

SCOP Domain Sequences for d1iyma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oliza sativa)}
amddgvecavclaeledgeearflprcghgfhaecvdmwlgshstcplcrltvvv

SCOP Domain Coordinates for d1iyma_:

Click to download the PDB-style file with coordinates for d1iyma_.
(The format of our PDB-style files is described here.)

Timeline for d1iyma_: