Lineage for d1iyid2 (1iyi D:602-675)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396311Protein Class sigma GST [81362] (4 species)
  7. 396315Species Human (Homo sapiens) [TaxId:9606] [89705] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 396323Domain d1iyid2: 1iyi D:602-675 [83805]
    Other proteins in same PDB: d1iyia1, d1iyib1, d1iyic1, d1iyid1
    complexed with ca, gsh

Details for d1iyid2

PDB Entry: 1iyi (more details), 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyid2 c.47.1.5 (D:602-675) Class sigma GST {Human (Homo sapiens)}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d1iyid2:

Click to download the PDB-style file with coordinates for d1iyid2.
(The format of our PDB-style files is described here.)

Timeline for d1iyid2: