SCOPe 2.03: Domain d1iyid1: 1iyi D:676-799

Lineage for d1iyid1 (1iyi D:676-799)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (13 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d1iyid1: 1iyi D:676-799 [83804]
   Other proteins in same PDB: d1iyia2, d1iyib2, d1iyic2, d1iyid2
   complexed with ca, gsh

Details for d1iyid1

PDB Entry: 1iyi, 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

PDB Compounds: (D:) hematopoietic prostagladin d synthase

SCOPe Domain Sequences for d1iyid1:

Sequence; same for both SEQRES and ATOM records:

>d1iyid1 a.45.1.1 (D:676-799) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d1iyid1:

• d1iyid1 first appeared in SCOP 1.65
  
• d1iyid1 appears in SCOPe 2.02
  
• d1iyid1 appears in SCOPe 2.04
  
• d1iyid1 appears in the current release, SCOPe 2.08