Lineage for d1iyfa_ (1iyf A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499566Protein Ubiquitin-like domain of parkin [89831] (2 species)
  7. 499567Species Human (Homo sapiens) [TaxId:9606] [89832] (1 PDB entry)
  8. 499568Domain d1iyfa_: 1iyf A: [83789]

Details for d1iyfa_

PDB Entry: 1iyf (more details)

PDB Description: solution structure of ubiquitin-like domain of human parkin

SCOP Domain Sequences for d1iyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyfa_ d.15.1.1 (A:) Ubiquitin-like domain of parkin {Human (Homo sapiens)}
mivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwtvqncd
ldqqsivhivqrpwrk

SCOP Domain Coordinates for d1iyfa_:

Click to download the PDB-style file with coordinates for d1iyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1iyfa_: