Lineage for d1iy8b_ (1iy8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842615Protein Levodione reductase [89523] (1 species)
  7. 2842616Species Corynebacterium aquaticum [TaxId:144185] [89524] (1 PDB entry)
  8. 2842618Domain d1iy8b_: 1iy8 B: [83775]
    complexed with mrd, nad

Details for d1iy8b_

PDB Entry: 1iy8 (more details), 1.6 Å

PDB Description: Crystal Structure of Levodione Reductase
PDB Compounds: (B:) levodione reductase

SCOPe Domain Sequences for d1iy8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iy8b_ c.2.1.2 (B:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}
rftdrvvlitgggsglgratavrlaaegaklslvdvssegleaskaavletapdaevltt
vadvsdeaqveayvtatterfgridgffnnagiegkqnptesftaaefdkvvsinlrgvf
lglekvlkimreqgsgmvvntasvggirgignqsgyaaakhgvvgltrnsaveygrygir
inaiapgaiwtpmvensmkqldpenprkaaeefiqvnpskrygeapeiaavvafllsdda
syvnatvvpidggqsaay

SCOPe Domain Coordinates for d1iy8b_:

Click to download the PDB-style file with coordinates for d1iy8b_.
(The format of our PDB-style files is described here.)

Timeline for d1iy8b_: