Lineage for d1iy6a_ (1iy6 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751855Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 751856Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 751857Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 751889Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 751896Species Silver pheasant (Lophura nycthemera) [TaxId:9046] [57472] (4 PDB entries)
  8. 751900Domain d1iy6a_: 1iy6 A: [83773]
    mutant

Details for d1iy6a_

PDB Entry: 1iy6 (more details)

PDB Description: solution structure of omsvp3 variant, p14c/n39c
PDB Compounds: (A:) omsvp3

SCOP Domain Sequences for d1iy6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iy6a_ g.68.1.1 (A:) Ovomucoid domains {Silver pheasant (Lophura nycthemera) [TaxId: 9046]}
avsvdcseypkcactmeyrplcgsdnktygnkcnfccavvesngtltlshfgkc

SCOP Domain Coordinates for d1iy6a_:

Click to download the PDB-style file with coordinates for d1iy6a_.
(The format of our PDB-style files is described here.)

Timeline for d1iy6a_: