Class g: Small proteins [56992] (85 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins) |
Protein Ovomucoid domains [57469] (3 species) unless specified in the comment, the listed structures are of domain III |
Species Silver pheasant (Lophura nycthemera) [TaxId:9046] [57472] (4 PDB entries) |
Domain d1iy6a_: 1iy6 A: [83773] mutant |
PDB Entry: 1iy6 (more details)
SCOP Domain Sequences for d1iy6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iy6a_ g.68.1.1 (A:) Ovomucoid domains {Silver pheasant (Lophura nycthemera) [TaxId: 9046]} avsvdcseypkcactmeyrplcgsdnktygnkcnfccavvesngtltlshfgkc
Timeline for d1iy6a_: