Lineage for d1ixea_ (1ixe A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004802Family a.103.1.1: Citrate synthase [48257] (2 protein domains)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2004803Protein Citrate synthase [48258] (7 species)
  7. 2004862Species Thermus thermophilus [TaxId:274] [89115] (2 PDB entries)
  8. 2004864Domain d1ixea_: 1ixe A: [83768]
    complexed with cit, coa, gol, so4

Details for d1ixea_

PDB Entry: 1ixe (more details), 2.3 Å

PDB Description: crystal structure of citrate synthase from thermus thermophilus hb8
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1ixea_:

Sequence, based on SEQRES records: (download)

>d1ixea_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]}
varglegvlftesrmcyidgqqgklyyygipiqelaekssfeettflllhgrlprrqele
efsaalarrralpahllesfkrypvsahpmsflrtavsefgmldptegdisrealyekgl
dliakfativaankrlkegkepippredlshaanflymangvepspeqarlmdaalilha
ehgfnastftaiaafstetdlysaitaavaslkgprhgganeavmrmiqeigtperarew
vreklakkerimgmghrvykafdpragvleklarlvaekhghskeyqilkiveeeagkvl
nprgiypnvdfysgvvysdlgfslefftpifavarisgwvghileyqeldnrllrpgaky
vgeldvpyvplear

Sequence, based on observed residues (ATOM records): (download)

>d1ixea_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]}
varglegvlftesrmcyidgqqgklyyygipiqelaekssfeettflllhgrlprrqele
efsaalarrralpahllesfkrypvsahpmsflrtavsefgmldptegdisrealyekgl
dliakfativaankrlkegkepippredlshaanflymangvepspeqarlmdaalilha
ehgfnastftaiaafstetdlysaitaavaslkgprhgganeavmrmiqeigtperarew
vreklakkerimgmghrvykafdpragvleklarlvaehskeyqilkiveeeagkvlnpr
giypnvdfysgvvysdlgfslefftpifavarisgwvghileyqeldnrllrpgakyvge
ldvpyvplear

SCOPe Domain Coordinates for d1ixea_:

Click to download the PDB-style file with coordinates for d1ixea_.
(The format of our PDB-style files is described here.)

Timeline for d1ixea_: