SCOPe 2.05: Domain d1ixcb2: 1ixc B:90-289

Lineage for d1ixcb2 (1ixc B:90-289)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein LysR-type regulatory protein CbnR [89789] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [89790] (2 PDB entries)

8. Domain d1ixcb2: 1ixc B:90-289 [83767]
   Other proteins in same PDB: d1ixca1, d1ixcb1

Details for d1ixcb2

PDB Entry: 1ixc, 2.2 Å

PDB Description: Crystal structure of CbnR, a LysR family transcriptional regulator

PDB Compounds: (B:) LysR-type regulatory protein

SCOPe Domain Sequences for d1ixcb2:

Sequence; same for both SEQRES and ATOM records:

>d1ixcb2 c.94.1.1 (B:90-289) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}
vgelsvayfgtpiyrslplllrafltstptatvslthmtkdeqvegllagtihvgfsrff
prhpgieivniaqedlylavhrsqsgkfgktckladlraveltlfprggrpsfadevigl
fkhagiepriarvvedataalaltmagaassivpasvaairwpdiafarivgtrvkvpis
cifrkekqppilarfvehvr

Timeline for d1ixcb2:

• d1ixcb2 first appeared in SCOP 1.65
  
• d1ixcb2 appears in SCOPe 2.04
  
• d1ixcb2 appears in SCOPe 2.06
  
• d1ixcb2 appears in the current release, SCOPe 2.08