Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins) contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer |
Protein LysR-type regulatory protein CbnR [88980] (1 species) |
Species Ralstonia eutropha [TaxId:106590] [88981] (2 PDB entries) |
Domain d1ixcb1: 1ixc B:1-89 [83766] Other proteins in same PDB: d1ixca2, d1ixcb2 complexed with mse |
PDB Entry: 1ixc (more details), 2.2 Å
SCOP Domain Sequences for d1ixcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixcb1 a.4.5.37 (B:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} mefrqlkyfiavaeagnmaaaakrlhvsqppitrqmqaleadlgvvllershrgieltaa ghafledarrilelagrsgdrsraaargd
Timeline for d1ixcb1: