Lineage for d1ix5a_ (1ix5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941339Protein Archaeal FKBP [89879] (1 species)
    contains insert all-beta subdomain; dual function: PPI and chaperone-like activities
  7. 2941340Species Methanococcus thermolithotrophicus [TaxId:2186] [89880] (1 PDB entry)
  8. 2941341Domain d1ix5a_: 1ix5 A: [83763]
    has additional subdomain(s) that are not in the common domain

Details for d1ix5a_

PDB Entry: 1ix5 (more details)

PDB Description: solution structure of the methanococcus thermolithotrophicus fkbp
PDB Compounds: (A:) fkbp

SCOPe Domain Sequences for d1ix5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Methanococcus thermolithotrophicus [TaxId: 2186]}
mvdkgvkikvdyigklesgdvfdtsieevakeagiyapdreyeplefvvgegqliqgfee
avldmevgdektvkipaekaygnrnemliqkiprdafkeadfepeegmvilaegipatit
evtdnevtldfnhelagkdlvftikiievve

SCOPe Domain Coordinates for d1ix5a_:

Click to download the PDB-style file with coordinates for d1ix5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ix5a_: