![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily) 11 stranded sheet partly folded in a corner-like structure filled with a few short helices |
![]() | Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) ![]() |
![]() | Family b.125.1.2: Outer membrane lipoprotein receptor LolB [89396] (1 protein) automatically mapped to Pfam PF03550 |
![]() | Protein Outer membrane lipoprotein receptor LolB [89397] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89398] (5 PDB entries) |
![]() | Domain d1iwna_: 1iwn A: [83760] complexed with pg5, so4 |
PDB Entry: 1iwn (more details), 2.2 Å
SCOPe Domain Sequences for d1iwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwna_ b.125.1.2 (A:) Outer membrane lipoprotein receptor LolB {Escherichia coli [TaxId: 562]} gkspdspqwrqhqqdvrnlnqyqtrgafayisdqqkvyarffwqqtgqdryrllltnplg stelelnaqpgnvqlvdnkgqrytaddaeemigkltgmpiplnslrqwilglpgdatdyk lddqyrlseitysqngknwkvvyggydtktqpampanmeltdggqriklkmdnwivk
Timeline for d1iwna_: