Lineage for d1iwma_ (1iwm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077315Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2077316Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2077340Family b.125.1.2: Outer membrane lipoprotein receptor LolB [89396] (1 protein)
    automatically mapped to Pfam PF03550
  6. 2077341Protein Outer membrane lipoprotein receptor LolB [89397] (1 species)
  7. 2077342Species Escherichia coli [TaxId:562] [89398] (5 PDB entries)
  8. 2077344Domain d1iwma_: 1iwm A: [83758]
    complexed with so4

Details for d1iwma_

PDB Entry: 1iwm (more details), 1.9 Å

PDB Description: Crystal Structure of the Outer Membrane Lipoprotein Receptor, LolB
PDB Compounds: (A:) Outer Membrane Lipoprotein LolB

SCOPe Domain Sequences for d1iwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwma_ b.125.1.2 (A:) Outer membrane lipoprotein receptor LolB {Escherichia coli [TaxId: 562]}
gkspdspqwrqhqqdvrnlnqyqtrgafayisdqqkvyarffwqqtgqdryrllltnplg
stelelnaqpgnvqlvdnkgqrytaddaeemigkltgmpiplnslrqwilglpgdatdyk
lddqyrlseitysqngknwkvvyggydtktqpampanmeltdggqriklkmdnwivk

SCOPe Domain Coordinates for d1iwma_:

Click to download the PDB-style file with coordinates for d1iwma_.
(The format of our PDB-style files is described here.)

Timeline for d1iwma_: