Lineage for d1iwla_ (1iwl A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411926Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2411927Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2411928Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 protein domains)
    automatically mapped to Pfam PF03548
  6. 2411929Protein Outer-membrane lipoproteins carrier protein LolA [89394] (1 species)
  7. 2411930Species Escherichia coli [TaxId:562] [89395] (3 PDB entries)
  8. 2411932Domain d1iwla_: 1iwl A: [83757]
    complexed with mg, zn

Details for d1iwla_

PDB Entry: 1iwl (more details), 1.65 Å

PDB Description: Crystal Structure of the Lipoprotein Localization Factor, LolA
PDB Compounds: (A:) Outer-membrane lipoproteins carrier protein

SCOPe Domain Sequences for d1iwla_:

Sequence, based on SEQRES records: (download)

>d1iwla_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]}
daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqpdesilv
sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
rk

Sequence, based on observed residues (ATOM records): (download)

>d1iwla_ b.125.1.1 (A:) Outer-membrane lipoproteins carrier protein LolA {Escherichia coli [TaxId: 562]}
daasdlksrldkvssfhasftqkvtdvqegqgdlwvkrpnlfnwhmtqpdesilvsdgkt
lwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkasngnlk
qftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddqrk

SCOPe Domain Coordinates for d1iwla_:

Click to download the PDB-style file with coordinates for d1iwla_.
(The format of our PDB-style files is described here.)

Timeline for d1iwla_: