Lineage for d1iwda_ (1iwd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926866Protein Ervatamin B [89803] (1 species)
  7. 2926867Species Adam's apple (Ervatamia coronaria) [TaxId:52861] [89804] (1 PDB entry)
  8. 2926868Domain d1iwda_: 1iwd A: [83756]
    complexed with thj

Details for d1iwda_

PDB Entry: 1iwd (more details), 1.63 Å

PDB Description: proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
PDB Compounds: (A:) ervatamin b

SCOPe Domain Sequences for d1iwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]}
lpsfvdwrskgavnsiknqkqcgscwafsavaavesinkirtgqlislseqelvdcdtas
hgcnggwmnnafqyiitnggidtqqnypysavqgsckpyrlrvvsingfqrvtrnnesal
qsavasqpvsvtveaagapfqhyssgiftgpcgtaqnhgvvivgygtqsgknywivrnsw
gqnwgnqgyiwmernvassaglcgiaqlpsyptka

SCOPe Domain Coordinates for d1iwda_:

Click to download the PDB-style file with coordinates for d1iwda_.
(The format of our PDB-style files is described here.)

Timeline for d1iwda_: