Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Ervatamin B [89803] (1 species) |
Species Adam's apple (Ervatamia coronaria) [TaxId:52861] [89804] (1 PDB entry) |
Domain d1iwda_: 1iwd A: [83756] complexed with thj |
PDB Entry: 1iwd (more details), 1.63 Å
SCOPe Domain Sequences for d1iwda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} lpsfvdwrskgavnsiknqkqcgscwafsavaavesinkirtgqlislseqelvdcdtas hgcnggwmnnafqyiitnggidtqqnypysavqgsckpyrlrvvsingfqrvtrnnesal qsavasqpvsvtveaagapfqhyssgiftgpcgtaqnhgvvivgygtqsgknywivrnsw gqnwgnqgyiwmernvassaglcgiaqlpsyptka
Timeline for d1iwda_: