Lineage for d1iwbl_ (1iwb L:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307706Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 307751Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (1 protein)
  6. 307752Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 307753Species Klebsiella oxytoca [TaxId:571] [51712] (7 PDB entries)
  8. 307761Domain d1iwbl_: 1iwb L: [83754]
    Other proteins in same PDB: d1iwbb_, d1iwbe_, d1iwbg_, d1iwbm_
    complexed with b12, k

Details for d1iwbl_

PDB Entry: 1iwb (more details), 1.85 Å

PDB Description: Crystal structure of diol dehydratase

SCOP Domain Sequences for d1iwbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwbl_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella oxytoca}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOP Domain Coordinates for d1iwbl_:

Click to download the PDB-style file with coordinates for d1iwbl_.
(The format of our PDB-style files is described here.)

Timeline for d1iwbl_: