SCOPe 2.06: Domain d1iwbg_: 1iwb G:

Lineage for d1iwbg_ (1iwb G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain
   automatically mapped to Pfam PF02287

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)

6. Protein Diol dehydratase, gamma subunit [47150] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries)

8. Domain d1iwbg_: 1iwb G: [83753]
   Other proteins in same PDB: d1iwba_, d1iwbb_, d1iwbe_, d1iwbl_
   complexed with b12, k

Details for d1iwbg_

PDB Entry: 1iwb, 1.85 Å

PDB Description: Crystal structure of diol dehydratase

PDB Compounds: (G:) DIOL DEHYDRATASE gamma chain

SCOPe Domain Sequences for d1iwbg_:

Sequence; same for both SEQRES and ATOM records:

>d1iwbg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

Timeline for d1iwbg_:

• d1iwbg_ first appeared in SCOP 1.65
  
• d1iwbg_ appears in SCOPe 2.05
  
• d1iwbg_ appears in SCOPe 2.07
  
• d1iwbg_ appears in the current release, SCOPe 2.08