Lineage for d1iwbe_ (1iwb E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489967Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2489968Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2489969Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2489970Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 2489978Domain d1iwbe_: 1iwb E: [83752]
    Other proteins in same PDB: d1iwba_, d1iwbg_, d1iwbl_, d1iwbm_
    complexed with b12, k

Details for d1iwbe_

PDB Entry: 1iwb (more details), 1.85 Å

PDB Description: Crystal structure of diol dehydratase
PDB Compounds: (E:) DIOL DEHYDRATASE beta chain

SCOPe Domain Sequences for d1iwbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwbe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv

SCOPe Domain Coordinates for d1iwbe_:

Click to download the PDB-style file with coordinates for d1iwbe_.
(The format of our PDB-style files is described here.)

Timeline for d1iwbe_: