Lineage for d1iwal_ (1iwa L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957678Species Galdieria partita [TaxId:83374] [55244] (2 PDB entries)
  8. 2957688Domain d1iwal_: 1iwa L: [83743]
    Other proteins in same PDB: d1iwaa1, d1iwaa2, d1iwac1, d1iwac2, d1iwae1, d1iwae2, d1iwag1, d1iwag2, d1iwai1, d1iwai2, d1iwak1, d1iwak2, d1iwam1, d1iwam2, d1iwao1, d1iwao2
    complexed with so4

Details for d1iwal_

PDB Entry: 1iwa (more details), 2.6 Å

PDB Description: rubisco from galdieria partita
PDB Compounds: (L:) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit

SCOPe Domain Sequences for d1iwal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwal_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
ikytihsyesykpedery

SCOPe Domain Coordinates for d1iwal_:

Click to download the PDB-style file with coordinates for d1iwal_.
(The format of our PDB-style files is described here.)

Timeline for d1iwal_: