Lineage for d1iwak2 (1iwa K:6-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952790Species Galdieria partita [TaxId:83374] [54971] (2 PDB entries)
  8. 2952800Domain d1iwak2: 1iwa K:6-149 [83742]
    Other proteins in same PDB: d1iwaa1, d1iwab_, d1iwac1, d1iwad_, d1iwae1, d1iwaf_, d1iwag1, d1iwah_, d1iwai1, d1iwaj_, d1iwak1, d1iwal_, d1iwam1, d1iwan_, d1iwao1, d1iwap_
    complexed with so4

Details for d1iwak2

PDB Entry: 1iwa (more details), 2.6 Å

PDB Description: rubisco from galdieria partita
PDB Compounds: (K:) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit

SCOPe Domain Sequences for d1iwak2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwak2 d.58.9.1 (K:6-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
fgfkavkalrledmrlplaylktfq

SCOPe Domain Coordinates for d1iwak2:

Click to download the PDB-style file with coordinates for d1iwak2.
(The format of our PDB-style files is described here.)

Timeline for d1iwak2: