SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1iwak2 (1iwa K:6-149)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175268Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2175269Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 2175280Species Galdieria partita [TaxId:83374] [54971] (2 PDB entries)
  8. 2175290Domain d1iwak2: 1iwa K:6-149 [83742]
    Other proteins in same PDB: d1iwaa1, d1iwab_, d1iwac1, d1iwad_, d1iwae1, d1iwaf_, d1iwag1, d1iwah_, d1iwai1, d1iwaj_, d1iwak1, d1iwal_, d1iwam1, d1iwan_, d1iwao1, d1iwap_
    complexed with so4

Details for d1iwak2

PDB Entry: 1iwa (more details), 2.6 Å

PDB Description: rubisco from galdieria partita
PDB Compounds: (K:) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit

SCOPe Domain Sequences for d1iwak2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwak2 d.58.9.1 (K:6-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
fgfkavkalrledmrlplaylktfq

SCOPe Domain Coordinates for d1iwak2:

Click to download the PDB-style file with coordinates for d1iwak2.
(The format of our PDB-style files is described here.)

Timeline for d1iwak2: