Lineage for d1iwaf_ (1iwa F:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413865Species Galdieria partita [TaxId:83374] [55244] (2 PDB entries)
  8. 413872Domain d1iwaf_: 1iwa F: [83734]
    Other proteins in same PDB: d1iwaa1, d1iwaa2, d1iwac1, d1iwac2, d1iwae1, d1iwae2, d1iwag1, d1iwag2, d1iwai1, d1iwai2, d1iwak1, d1iwak2, d1iwam1, d1iwam2, d1iwao1, d1iwao2

Details for d1iwaf_

PDB Entry: 1iwa (more details), 2.6 Å

PDB Description: rubisco from galdieria partita

SCOP Domain Sequences for d1iwaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwaf_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
ikytihsyesykpedery

SCOP Domain Coordinates for d1iwaf_:

Click to download the PDB-style file with coordinates for d1iwaf_.
(The format of our PDB-style files is described here.)

Timeline for d1iwaf_: