Lineage for d1iwae1 (1iwa E:150-478)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386354Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 386355Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 386356Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 386389Species Galdieria partita [TaxId:83374] [51654] (2 PDB entries)
  8. 386396Domain d1iwae1: 1iwa E:150-478 [83732]
    Other proteins in same PDB: d1iwaa2, d1iwab_, d1iwac2, d1iwad_, d1iwae2, d1iwaf_, d1iwag2, d1iwah_, d1iwai2, d1iwaj_, d1iwak2, d1iwal_, d1iwam2, d1iwan_, d1iwao2, d1iwap_

Details for d1iwae1

PDB Entry: 1iwa (more details), 2.6 Å

PDB Description: rubisco from galdieria partita

SCOP Domain Sequences for d1iwae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwae1 c.1.14.1 (E:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylftmeavnkasaatgevkghylnvtaatmeemyaranfakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmewaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqagatanrvaleamilarnenrdyltegpeilreaak
tcgalrtaldlwkditfnytstdtsdfv

SCOP Domain Coordinates for d1iwae1:

Click to download the PDB-style file with coordinates for d1iwae1.
(The format of our PDB-style files is described here.)

Timeline for d1iwae1: