Lineage for d1iwac1 (1iwa C:150-478)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973964Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 973965Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 973966Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 973977Species Galdieria partita [TaxId:83374] [51654] (2 PDB entries)
  8. 973983Domain d1iwac1: 1iwa C:150-478 [83729]
    Other proteins in same PDB: d1iwaa2, d1iwab_, d1iwac2, d1iwad_, d1iwae2, d1iwaf_, d1iwag2, d1iwah_, d1iwai2, d1iwaj_, d1iwak2, d1iwal_, d1iwam2, d1iwan_, d1iwao2, d1iwap_
    complexed with so4

Details for d1iwac1

PDB Entry: 1iwa (more details), 2.6 Å

PDB Description: rubisco from galdieria partita
PDB Compounds: (C:) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit

SCOPe Domain Sequences for d1iwac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwac1 c.1.14.1 (C:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylftmeavnkasaatgevkghylnvtaatmeemyaranfakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmewaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqagatanrvaleamilarnenrdyltegpeilreaak
tcgalrtaldlwkditfnytstdtsdfv

SCOPe Domain Coordinates for d1iwac1:

Click to download the PDB-style file with coordinates for d1iwac1.
(The format of our PDB-style files is described here.)

Timeline for d1iwac1: