SCOPe 2.07: Domain d1iw1b_: 1iw1 B:

Lineage for d1iw1b_ (1iw1 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d1iw1b_: 1iw1 B: [83724]
   complexed with hem, so4, suc

Details for d1iw1b_

PDB Entry: 1iw1, 1.5 Å

PDB Description: crystal structure of a heme oxygenase (hmuo) from corynebacterium diphtheriae complexed with heme in the ferrous state

PDB Compounds: (B:) Heme oxygenase

SCOPe Domain Sequences for d1iw1b_:

Sequence; same for both SEQRES and ATOM records:

>d1iw1b_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

Timeline for d1iw1b_:

• d1iw1b_ first appeared in SCOP 1.65
  
• d1iw1b_ appears in SCOPe 2.06
  
• d1iw1b_ appears in the current release, SCOPe 2.08