Lineage for d1iw1a_ (1iw1 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286010Fold a.132: Heme oxygenase [48612] (1 superfamily)
    multihelical; bundle
  4. 286011Superfamily a.132.1: Heme oxygenase [48613] (2 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 286012Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 286013Protein Heme oxygenase HmuO [89159] (1 species)
  7. 286014Species Corynebacterium diphtheriae [TaxId:1717] [89160] (2 PDB entries)
  8. 286018Domain d1iw1a_: 1iw1 A: [83723]

Details for d1iw1a_

PDB Entry: 1iw1 (more details), 1.5 Å

PDB Description: crystal structure of a heme oxygenase (hmuo) from corynebacterium diphtheriae complexed with heme in the ferrous state

SCOP Domain Sequences for d1iw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw1a_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae}
ttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavd
avrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvd
gpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekln
nlelsdeqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d1iw1a_:

Click to download the PDB-style file with coordinates for d1iw1a_.
(The format of our PDB-style files is described here.)

Timeline for d1iw1a_: