SCOP 1.71: Domain d1iw0c_: 1iw0 C:

Lineage for d1iw0c_ (1iw0 C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (6 PDB entries)

8. Domain d1iw0c_: 1iw0 C: [83722]
   complexed with hem, so4, suc

Details for d1iw0c_

PDB Entry: 1iw0, 1.4 Å

PDB Description: crystal structure of a heme oxygenase (hmuo) from corynebacterium diphtheriae complexed with heme in the ferric state

SCOP Domain Sequences for d1iw0c_:

Sequence; same for both SEQRES and ATOM records:

>d1iw0c_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d1iw0c_:

• d1iw0c_ first appeared in SCOP 1.65
  
• d1iw0c_ appears in SCOP 1.69
  
• d1iw0c_ appears in SCOP 1.73
  
• d1iw0c_ appears in the current release, SCOPe 2.08