Lineage for d1iw0c_ (1iw0 C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286010Fold a.132: Heme oxygenase [48612] (1 superfamily)
    multihelical; bundle
  4. 286011Superfamily a.132.1: Heme oxygenase [48613] (2 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 286012Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 286013Protein Heme oxygenase HmuO [89159] (1 species)
  7. 286014Species Corynebacterium diphtheriae [TaxId:1717] [89160] (2 PDB entries)
  8. 286017Domain d1iw0c_: 1iw0 C: [83722]
    complexed with hem, so4, suc

Details for d1iw0c_

PDB Entry: 1iw0 (more details), 1.4 Å

PDB Description: crystal structure of a heme oxygenase (hmuo) from corynebacterium diphtheriae complexed with heme in the ferric state

SCOP Domain Sequences for d1iw0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw0c_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d1iw0c_:

Click to download the PDB-style file with coordinates for d1iw0c_.
(The format of our PDB-style files is described here.)

Timeline for d1iw0c_: