Lineage for d1iw0b_ (1iw0 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448927Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 448928Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 448929Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 448930Protein Heme oxygenase HmuO [89159] (1 species)
  7. 448931Species Corynebacterium diphtheriae [TaxId:1717] [89160] (3 PDB entries)
  8. 448933Domain d1iw0b_: 1iw0 B: [83721]

Details for d1iw0b_

PDB Entry: 1iw0 (more details), 1.4 Å

PDB Description: crystal structure of a heme oxygenase (hmuo) from corynebacterium diphtheriae complexed with heme in the ferric state

SCOP Domain Sequences for d1iw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw0b_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

SCOP Domain Coordinates for d1iw0b_:

Click to download the PDB-style file with coordinates for d1iw0b_.
(The format of our PDB-style files is described here.)

Timeline for d1iw0b_: