![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
![]() | Protein Hypothetical protein TT1466 [89542] (1 species) putative CoA-binding protein |
![]() | Species Thermus thermophilus [TaxId:274] [89543] (2 PDB entries) |
![]() | Domain d1iula_: 1iul A: [83713] structural genomics; cell-free system protein |
PDB Entry: 1iul (more details), 2 Å
SCOPe Domain Sequences for d1iula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iula_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv vadrclmvehkrlf
Timeline for d1iula_: