SCOPe 2.04: Domain d1iula_: 1iul A:

Lineage for d1iula_ (1iul A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Hypothetical protein TT1466 [89542] (1 species)
   putative CoA-binding protein

7. Species Thermus thermophilus [TaxId:274] [89543] (2 PDB entries)

8. Domain d1iula_: 1iul A: [83713]
   structural genomics; cell-free system protein

Details for d1iula_

PDB Entry: 1iul, 2 Å

PDB Description: The structure of cell-free ID.343 from Thermus thermophilus

PDB Compounds: (A:) hypothetical protein TT1466

SCOPe Domain Sequences for d1iula_:

Sequence; same for both SEQRES and ATOM records:

>d1iula_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]}
mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea
vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv
vadrclmvehkrlf

Timeline for d1iula_:

• d1iula_ first appeared in SCOP 1.65
  
• d1iula_ appears in SCOPe 2.03
  
• d1iula_ appears in SCOPe 2.05
  
• d1iula_ appears in the current release, SCOPe 2.08