Lineage for d1iula_ (1iul A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845549Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2845563Protein Hypothetical protein TT1466 [89542] (1 species)
    putative CoA-binding protein
  7. 2845564Species Thermus thermophilus [TaxId:274] [89543] (2 PDB entries)
  8. 2845565Domain d1iula_: 1iul A: [83713]
    structural genomics; cell-free system protein

Details for d1iula_

PDB Entry: 1iul (more details), 2 Å

PDB Description: The structure of cell-free ID.343 from Thermus thermophilus
PDB Compounds: (A:) hypothetical protein TT1466

SCOPe Domain Sequences for d1iula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iula_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]}
mndqelraylsqaktiavlgahkdpsrpahyvprylreqgyrvlpvnprfqgeelfgeea
vaslldlkepvdildvfrppsalmdhlpevlalrpglvwlqsgirhpefekalkeagipv
vadrclmvehkrlf

SCOPe Domain Coordinates for d1iula_:

Click to download the PDB-style file with coordinates for d1iula_.
(The format of our PDB-style files is described here.)

Timeline for d1iula_: