SCOPe 2.08: Domain d1iu3c1: 1iu3 C:6-116

Lineage for d1iu3c1 (1iu3 C:6-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily)
   consists of seven alpha-helices and three-stranded beta-sheet

4. Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family)
   automatically mapped to Pfam PF03925

5. Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (2 proteins)

6. Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species)
   binds to fully methylated and hemimethylated GATC sequences at oriC

7. Species Escherichia coli [TaxId:562] [82811] (3 PDB entries)
   Uniprot P36658 71-181

8. Domain d1iu3c1: 1iu3 C:6-116 [83709]
   Other proteins in same PDB: d1iu3c2, d1iu3f2
   protein/DNA complex

Details for d1iu3c1

PDB Entry: 1iu3, 3 Å

PDB Description: crystal structure of the e.coli seqa protein complexed with hemimethylated dna

PDB Compounds: (C:) SeqA protein

SCOPe Domain Sequences for d1iu3c1:

Sequence; same for both SEQRES and ATOM records:

>d1iu3c1 d.228.1.1 (C:6-116) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
amrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllk
ngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti

Timeline for d1iu3c1:

• d1iu3c1 first appeared in SCOP 1.65, called d1iu3c_
  
• d1iu3c1 appears in SCOPe 2.07