SCOPe 2.05: Domain d1ipfa_: 1ipf A:

Lineage for d1ipfa_ (1ipf A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Tropinone reductase [51795] (3 species)

7. Species Jimsonweed (Datura stramonium), II [TaxId:4076] [51797] (4 PDB entries)

8. Domain d1ipfa_: 1ipf A: [83702]
   complexed with ndp, tne

Details for d1ipfa_

PDB Entry: 1ipf, 2.5 Å

PDB Description: tropinone reductase-ii complexed with nadph and tropinone

PDB Compounds: (A:) tropinone reductase-II

SCOPe Domain Sequences for d1ipfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ipfa_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}
agrwnlegctalvtggsrgigygiveelaslgasvytcsrnqkelndcltqwrskgfkve
asvcdlssrserqelmntvanhfhgklnilvnnagiviykeakdytvedyslimsinfea
ayhlsvlahpflkasergnvvfissvsgalavpyeavygatkgamdqltrclafewakdn
irvngvgpgviatslvemtiqdpeqkenlnklidrcalrrmgepkelaamvaflcfpaas
yvtgqiiyvdgglmancgf

Timeline for d1ipfa_:

• d1ipfa_ first appeared in SCOP 1.65
  
• d1ipfa_ appears in SCOPe 2.04
  
• d1ipfa_ appears in SCOPe 2.06
  
• d1ipfa_ appears in the current release, SCOPe 2.08