Lineage for d1ii3a_ (1ii3 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058099Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2058100Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2058101Protein Staphylococcal nuclease [50201] (1 species)
  7. 2058102Species Staphylococcus aureus [TaxId:1280] [50202] (258 PDB entries)
    Uniprot P00644 89-223
  8. 2058172Domain d1ii3a_: 1ii3 A: [83690]
    mutant

Details for d1ii3a_

PDB Entry: 1ii3 (more details), 1.72 Å

PDB Description: structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1ii3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii3a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
klhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
lenakklevefdkgqrtdkygrglaylyadgkmlnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws

SCOPe Domain Coordinates for d1ii3a_:

Click to download the PDB-style file with coordinates for d1ii3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ii3a_: