Lineage for d1i6xb2 (1i6x B:8-137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816665Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 2816666Species Escherichia coli [TaxId:562] [51212] (32 PDB entries)
  8. 2816674Domain d1i6xb2: 1i6x B:8-137 [83676]
    Other proteins in same PDB: d1i6xa1, d1i6xb1
    complexed with cmp, trs; mutant

Details for d1i6xb2

PDB Entry: 1i6x (more details), 2.2 Å

PDB Description: structure of a star mutant crp-camp at 2.2 a
PDB Compounds: (B:) catabolite gene activator protein

SCOPe Domain Sequences for d1i6xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6xb2 b.82.3.2 (B:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikheegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOPe Domain Coordinates for d1i6xb2:

Click to download the PDB-style file with coordinates for d1i6xb2.
(The format of our PDB-style files is described here.)

Timeline for d1i6xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i6xb1