SCOP 1.73: Domain d1i6xb1: 1i6x B:138-207

Lineage for d1i6xb1 (1i6x B:138-207)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (19 PDB entries)

8. Domain d1i6xb1: 1i6x B:138-207 [83675]
   Other proteins in same PDB: d1i6xa2, d1i6xb2
   complexed with cmp, trs; mutant

Details for d1i6xb1

PDB Entry: 1i6x, 2.2 Å

PDB Description: structure of a star mutant crp-camp at 2.2 a

PDB Compounds: (B:) catabolite gene activator protein

SCOP Domain Sequences for d1i6xb1:

Sequence; same for both SEQRES and ATOM records:

>d1i6xb1 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d1i6xb1:

• d1i6xb1 first appeared in SCOP 1.65
  
• d1i6xb1 appears in SCOP 1.71
  
• d1i6xb1 appears in SCOP 1.75
  
• d1i6xb1 appears in the current release, SCOPe 2.08