Lineage for d1i5zb1 (1i5z B:138-207)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 634956Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins)
  6. 634957Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 634958Species Escherichia coli [TaxId:562] [46798] (19 PDB entries)
  8. 634960Domain d1i5zb1: 1i5z B:138-207 [83671]
    Other proteins in same PDB: d1i5za2, d1i5zb2
    complexed with cmp, trs

Details for d1i5zb1

PDB Entry: 1i5z (more details), 1.9 Å

PDB Description: structure of crp-camp at 1.9 a
PDB Compounds: (B:) catabolite gene activator protein

SCOP Domain Sequences for d1i5zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5zb1 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOP Domain Coordinates for d1i5zb1:

Click to download the PDB-style file with coordinates for d1i5zb1.
(The format of our PDB-style files is described here.)

Timeline for d1i5zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i5zb2