SCOP 1.65: Domain d1i3za_: 1i3z A:

Lineage for d1i3za_ (1i3z A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (25 proteins)

6. Protein Ews/fli1 activated transcript 2, Eat2 [89999] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [90000] (1 PDB entry)

8. Domain d1i3za_: 1i3z A: [83667]
   complex with slam phosphopeptide, chain B
   complexed with ptr

Details for d1i3za_

PDB Entry: 1i3z, 2.15 Å

PDB Description: murine eat2 sh2 domain in complex with slam phosphopeptide

SCOP Domain Sequences for d1i3za_:

Sequence; same for both SEQRES and ATOM records:

>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus)}
mdlpyyhgcltkrecealllkggvdgnflirdsesvpgalclcvsfkklvysyrifrekh
gyyrietdahtprtifpnlqelvskygkpgqglvvhlsnpimr

Timeline for d1i3za_:

• d1i3za_ is new in SCOP 1.65
  
• d1i3za_ appears in SCOP 1.67
  
• d1i3za_ appears in the current release, SCOPe 2.08