Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Ews/fli1 activated transcript 2, Eat2 [89999] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [90000] (1 PDB entry) |
Domain d1i3za_: 1i3z A: [83667] complex with slam phosphopeptide, chain B |
PDB Entry: 1i3z (more details), 2.15 Å
SCOPe Domain Sequences for d1i3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} mdlpyyhgcltkrecealllkggvdgnflirdsesvpgalclcvsfkklvysyrifrekh gyyrietdahtprtifpnlqelvskygkpgqglvvhlsnpimr
Timeline for d1i3za_: