Lineage for d1i2ca_ (1i2c A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308075Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 308413Protein Sulfolipid biosynthesis protein SQD1 [51763] (1 species)
  7. 308414Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51764] (4 PDB entries)
  8. 308416Domain d1i2ca_: 1i2c A: [83666]
    complexed with nad, so4, upg; mutant

Details for d1i2ca_

PDB Entry: 1i2c (more details), 1.6 Å

PDB Description: crystal structure of mutant t145a sqd1 protein complex with nad and udp-glucose

SCOP Domain Sequences for d1i2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2ca_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana)}
gsrvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisr
wkaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnn
vigtlnvlfaikefgeechlvklgamgeygtpnidieegyitithngrtdtlpypkqass
fyhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtal
nrfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsv
nelaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsl
lnfavqfkdrvdtkqimpsvswkkigvktksmt

SCOP Domain Coordinates for d1i2ca_:

Click to download the PDB-style file with coordinates for d1i2ca_.
(The format of our PDB-style files is described here.)

Timeline for d1i2ca_: