SCOPe 2.08: Domain d1i2ca1: 1i2c A:3-393

Lineage for d1i2ca1 (1i2c A:3-393)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Sulfolipid biosynthesis protein SQD1 [51763] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51764] (4 PDB entries)

8. Domain d1i2ca1: 1i2c A:3-393 [83666]
   Other proteins in same PDB: d1i2ca2
   complexed with nad, so4, upg; mutant
   has additional subdomain(s) that are not in the common domain

Details for d1i2ca1

PDB Entry: 1i2c, 1.6 Å

PDB Description: crystal structure of mutant t145a sqd1 protein complex with nad and udp-glucose

PDB Compounds: (A:) sulfolipid biosynthesis protein sqd1

SCOPe Domain Sequences for d1i2ca1:

Sequence; same for both SEQRES and ATOM records:

>d1i2ca1 c.2.1.2 (A:3-393) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisrwk
altgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnnvi
gtlnvlfaikefgeechlvklgamgeygtpnidieegyitithngrtdtlpypkqassfy
hlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtalnr
fcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsvne
laslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldslln
favqfkdrvdtkqimpsvswkkigvktksmt

Timeline for d1i2ca1:

• d1i2ca1 first appeared in SCOP 1.65, called d1i2ca_
  
• d1i2ca1 appears in SCOPe 2.07