SCOP 1.71: Domain d1i2ba_: 1i2b A:

Lineage for d1i2ba_ (1i2b A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Sulfolipid biosynthesis protein SQD1 [51763] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51764] (4 PDB entries)

8. Domain d1i2ba_: 1i2b A: [83665]
   complexed with nad, so4, upg, usq; mutant

Details for d1i2ba_

PDB Entry: 1i2b, 1.75 Å

PDB Description: crystal structure of mutant t145a sqd1 protein complex with nad and udp-sulfoquinovose/udp-glucose

SCOP Domain Sequences for d1i2ba_:

Sequence; same for both SEQRES and ATOM records:

>d1i2ba_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana)}
gsrvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisr
wkaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnn
vigtlnvlfaikefgeechlvklgamgeygtpnidieegyitithngrtdtlpypkqass
fyhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtal
nrfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsv
nelaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsl
lnfavqfkdrvdtkqimpsvswkkigvktksmt

Timeline for d1i2ba_:

• d1i2ba_ first appeared in SCOP 1.65
  
• d1i2ba_ appears in SCOP 1.69
  
• d1i2ba_ appears in SCOP 1.73
  
• d1i2ba_ appears in the current release, SCOPe 2.08, called d1i2ba1