Lineage for d1i24a1 (1i24 A:3-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842814Protein Sulfolipid biosynthesis protein SQD1 [51763] (1 species)
  7. 2842815Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51764] (4 PDB entries)
  8. 2842816Domain d1i24a1: 1i24 A:3-393 [83663]
    Other proteins in same PDB: d1i24a2
    complexed with nad, so4, upg
    has additional subdomain(s) that are not in the common domain

Details for d1i24a1

PDB Entry: 1i24 (more details), 1.2 Å

PDB Description: high resolution crystal structure of the wild-type protein sqd1, with nad and udp-glucose
PDB Compounds: (A:) sulfolipid biosynthesis protein sqd1

SCOPe Domain Sequences for d1i24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i24a1 c.2.1.2 (A:3-393) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisrwk
altgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnnvi
gtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtdtlpypkqassfy
hlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtalnr
fcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsvne
laslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldslln
favqfkdrvdtkqimpsvswkkigvktksmt

SCOPe Domain Coordinates for d1i24a1:

Click to download the PDB-style file with coordinates for d1i24a1.
(The format of our PDB-style files is described here.)

Timeline for d1i24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i24a2