Lineage for d1i0ec1 (1i0e C:8-102)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772927Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 772928Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 772929Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 772940Protein Creatine kinase, N-domain [48036] (7 species)
  7. 772962Species Human (Homo sapiens), muscle isoform [TaxId:9606] [89088] (1 PDB entry)
  8. 772965Domain d1i0ec1: 1i0e C:8-102 [83659]
    Other proteins in same PDB: d1i0ea2, d1i0eb2, d1i0ec2, d1i0ed2

Details for d1i0ec1

PDB Entry: 1i0e (more details), 3.5 Å

PDB Description: crystal structure of creatine kinase from human muscle
PDB Compounds: (C:) creatine kinase,m chain

SCOP Domain Sequences for d1i0ec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ec1 a.83.1.1 (C:8-102) Creatine kinase, N-domain {Human (Homo sapiens), muscle isoform [TaxId: 9606]}
nkfklnykpeeeypdlskhnnhmakvltlelykklrdketpsgftvddviqtgvdnpghp
fimtvgcvagdeesyevfkelfdpiisdrhggykp

SCOP Domain Coordinates for d1i0ec1:

Click to download the PDB-style file with coordinates for d1i0ec1.
(The format of our PDB-style files is described here.)

Timeline for d1i0ec1: