![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) ![]() |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Creatine kinase, N-domain [48036] (7 species) |
![]() | Species Human (Homo sapiens), muscle isoform [TaxId:9606] [89088] (1 PDB entry) |
![]() | Domain d1i0eb1: 1i0e B:8-102 [83657] Other proteins in same PDB: d1i0ea2, d1i0eb2, d1i0ec2, d1i0ed2 |
PDB Entry: 1i0e (more details), 3.5 Å
SCOP Domain Sequences for d1i0eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0eb1 a.83.1.1 (B:8-102) Creatine kinase, N-domain {Human (Homo sapiens), muscle isoform [TaxId: 9606]} nkfklnykpeeeypdlskhnnhmakvltlelykklrdketpsgftvddviqtgvdnpghp fimtvgcvagdeesyevfkelfdpiisdrhggykp
Timeline for d1i0eb1: