SCOP 1.65: Domain d1hxzb_: 1hxz B:

Lineage for d1hxzb_ (1hxz B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (98 PDB entries)

8. Domain d1hxzb_: 1hxz B: [83650]
   complexed with miniprotein MP-2, chains C and D

Details for d1hxzb_

PDB Entry: 1hxz, 1.8 Å

PDB Description: miniprotein mp-2 complex with streptavidin

SCOP Domain Sequences for d1hxzb_:

Sequence; same for both SEQRES and ATOM records:

>d1hxzb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1hxzb_:

• d1hxzb_ is new in SCOP 1.65
  
• d1hxzb_ appears in SCOP 1.67
  
• d1hxzb_ appears in the current release, SCOPe 2.08